Anti-IL13RA2

Catalog Number: ATA-HPA045831
Article Name: Anti-IL13RA2
Biozol Catalog Number: ATA-HPA045831
Supplier Catalog Number: HPA045831
Alternative Catalog Number: ATA-HPA045831-100,ATA-HPA045831-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CD213a2, CT19, IL-13R, IL13BP
Clonality: Polyclonal
Isotype: IgG
NCBI: 3598
UniProt: Q14627
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YLGYLYLQWQPPLSLDHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQS
Target: IL13RA2
Antibody Type: Monoclonal Antibody
HPA045831-100ul