Anti-INTS5

Catalog Number: ATA-HPA046181
Article Name: Anti-INTS5
Biozol Catalog Number: ATA-HPA046181
Supplier Catalog Number: HPA046181
Alternative Catalog Number: ATA-HPA046181-100,ATA-HPA046181-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: INT5, KIAA1698
Clonality: Polyclonal
Isotype: IgG
NCBI: 80789
UniProt: Q6P9B9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TNRRHTAAVPGPGGIWSVFHAGVIGRGLKPPKFVQSRNQQEVIYNTQSLLSLLVHCCSAPGGTECGECWGAPILSPEAAKAVAVTLVESVCPDAA
Target: INTS5
Antibody Type: Monoclonal Antibody
HPA046181-100ul