Anti-FAM173A

Catalog Number: ATA-HPA046262
Article Name: Anti-FAM173A
Biozol Catalog Number: ATA-HPA046262
Supplier Catalog Number: HPA046262
Alternative Catalog Number: ATA-HPA046262-100,ATA-HPA046262-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C16orf24, MGC2494
family with sequence similarity 173, member A
Anti-FAM173A
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 65990
UniProt: Q9BQD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: CAGSVCYRRKDLWKVSLRDCRNVSVFLAPSVLPLLEDKLRTELPAGARVVSGRFPLPTWQPVTAVGEGLDRVWAYDVPEGGQAGEAASSRIPIQAA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FAM173A
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-FAM173A antibody. Corresponding FAM173A RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA046262-100ul
HPA046262-100ul
HPA046262-100ul