Anti-RPAP2
Catalog Number:
ATA-HPA046443
- Images (8)
| Article Name: | Anti-RPAP2 |
| Biozol Catalog Number: | ATA-HPA046443 |
| Supplier Catalog Number: | HPA046443 |
| Alternative Catalog Number: | ATA-HPA046443-100,ATA-HPA046443-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ChIP, ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C1orf82, FLJ13150 |
| RNA polymerase II associated protein 2 |
| Anti-RPAP2 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 79871 |
| UniProt: | Q8IXW5 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RCSRKAAGTKQTSTLKQEDASKRKAELEAAVRKKIEFERKALHIVEQLLEENITEEFLMECGRFITPAHYSDVVDERSIVKLCGYPLCQKKLGI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RPAP2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows positivity in nucleoli & cytoplasm. |
|
|
Immunohistochemical staining of human duodenum shows moderate nuclear and cytoplasmic positivity in glandular cells. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) Lane 5: Human liver tissue Lane 6: Human tonsil tissue |
|
|
|
|
|
HPA046443-100ul |
|
|
|
|
|
HPA046443-100ul |
|
|
HPA046443-100ul |
Product Guarantee and Expert Support
