Anti-RFPL2

Catalog Number: ATA-HPA046608
Article Name: Anti-RFPL2
Biozol Catalog Number: ATA-HPA046608
Supplier Catalog Number: HPA046608
Alternative Catalog Number: ATA-HPA046608-100,ATA-HPA046608-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: RNF79
Clonality: Polyclonal
Isotype: IgG
NCBI: 10739
UniProt: O75678
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MEVAELGFPETAVSQSRICLCAVLCGHWDFADMMVIRSLSLIRLEGVEGRDPVGGGNLTN
Target: RFPL2
Antibody Type: Monoclonal Antibody
HPA046608-100ul