Anti-RNASEL

Catalog Number: ATA-HPA046758
Article Name: Anti-RNASEL
Biozol Catalog Number: ATA-HPA046758
Supplier Catalog Number: HPA046758
Alternative Catalog Number: ATA-HPA046758-100,ATA-HPA046758-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PRCA1, RNS4
Clonality: Polyclonal
Concentration: 0,1
NCBI: 6041
UniProt: Q05823
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: IKTRKSESEILRLLQPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGAGGA
Target: RNASEL
HPA046758-100ul