Anti-AQP2
Catalog Number:
ATA-HPA046834
- Images (8)
| Article Name: | Anti-AQP2 |
| Biozol Catalog Number: | ATA-HPA046834 |
| Supplier Catalog Number: | HPA046834 |
| Alternative Catalog Number: | ATA-HPA046834-100,ATA-HPA046834-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | AQP2 |
| aquaporin 2 (collecting duct) |
| Anti-AQP2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 359 |
| UniProt: | P41181 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VLFPPAKSLSERLAVLKGLEPDTDWEEREVRRRQSVELHSPQSL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | AQP2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human kidney and colon tissues using HPA046834 antibody. Corresponding AQP2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney shows moderate positivity in luminal membrane in cells in tubules. |
|
|
Immunohistochemical staining of human colon shows no cytoplasmic positivity in glandular cells as expected. |
|
|
Immunohistochemical staining of human fallopian tube shows no positivity in glandular cells as expected. |
|
|
Immunohistochemical staining of human prostate shows no positivity in as expected. |
|
|
HPA046834-100ul |
|
|
HPA046834-100ul |
|
|
HPA046834-100ul |
Product Guarantee and Expert Support
