Anti-RGS14
Catalog Number:
ATA-HPA046847
- Images (6)
| Article Name: | Anti-RGS14 |
| Biozol Catalog Number: | ATA-HPA046847 |
| Supplier Catalog Number: | HPA046847 |
| Alternative Catalog Number: | ATA-HPA046847-100,ATA-HPA046847-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | RGS14 |
| regulator of G-protein signaling 14 |
| Anti-RGS14 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 10636 |
| UniProt: | O43566 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LTIRDMLAGICEKRGLSLPDIKVYLVGNEQKALVLDQDCTVLADQEVRLENRITFELELTALERVVRISAKP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RGS14 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using Anti-RGS14 antibody. Corresponding RGS14 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human lymph node shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
HPA046847-100ul |
|
|
HPA046847-100ul |
|
|
HPA046847-100ul |
Product Guarantee and Expert Support
