Anti-SLC44A4
Catalog Number:
ATA-HPA046977
- Images (6)
| Article Name: | Anti-SLC44A4 |
| Biozol Catalog Number: | ATA-HPA046977 |
| Supplier Catalog Number: | HPA046977 |
| Alternative Catalog Number: | ATA-HPA046977-100,ATA-HPA046977-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C6orf29, CTL4, FLJ14491, NG22, TPPT |
| solute carrier family 44, member 4 |
| Anti-SLC44A4 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 80736 |
| UniProt: | Q53GD3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RQVLYPRNSTGAYCGMGENKDKPYLLYFNIFSCILSSNIISVAENGLQCPTPQVCVSSCPEDPWTVGKNEFSQTVGEVFYTKNRNFCLPGV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLC44A4 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human duodenum and liver tissues using Anti-SLC44A4 antibody. Corresponding SLC44A4 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human duodenum shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
HPA046977-100ul |
|
|
HPA046977-100ul |
|
|
HPA046977-100ul |
Product Guarantee and Expert Support
