Anti-IDUA
Catalog Number:
ATA-HPA046979
- Images (6)
| Article Name: | Anti-IDUA |
| Biozol Catalog Number: | ATA-HPA046979 |
| Supplier Catalog Number: | HPA046979 |
| Alternative Catalog Number: | ATA-HPA046979-100,ATA-HPA046979-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MPS1 |
| iduronidase, alpha-L- |
| Anti-IDUA |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 3425 |
| UniProt: | P35475 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | IDUA |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 |
|
|
HPA046979-100ul |
|
|
|
|
|
HPA046979-100ul |
|
|
HPA046979-100ul |
Product Guarantee and Expert Support
