Anti-ACVR2A
Catalog Number:
ATA-HPA046997
- Images (8)
| Article Name: | Anti-ACVR2A |
| Biozol Catalog Number: | ATA-HPA046997 |
| Supplier Catalog Number: | HPA046997 |
| Alternative Catalog Number: | ATA-HPA046997-100,ATA-HPA046997-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ACTRII, ACVR2 |
| activin A receptor, type IIA |
| Anti-ACVR2A |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 92 |
| UniProt: | P27037 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | CEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPYYN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ACVR2A |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human skin shows moderate to strong membranous positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human gastrointestinal shows moderate to strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human endometrium shows moderate to strong membranous positivity in glandular cells. |
|
|
HPA046997-100ul |
|
|
HPA046997-100ul |
|
|
HPA046997-100ul |
Product Guarantee and Expert Support
