Anti-MSANTD1

Catalog Number: ATA-HPA047003
Article Name: Anti-MSANTD1
Biozol Catalog Number: ATA-HPA047003
Supplier Catalog Number: HPA047003
Alternative Catalog Number: ATA-HPA047003-100,ATA-HPA047003-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C4orf44, LOC345222
Clonality: Polyclonal
Concentration: 0,05
NCBI: 345222
UniProt: Q6ZTZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GYLVSPQAEKHRRARNWTDAEMRGLMLVWEEFFDELKQTKRNAKVYEKMASKLFEMTGERRLGEEIKIKITNMTFQ
Target: MSANTD1
HPA047003-100ul