Anti-TRMT6
Catalog Number:
ATA-HPA047032
- Images (7)
| Article Name: | Anti-TRMT6 |
| Biozol Catalog Number: | ATA-HPA047032 |
| Supplier Catalog Number: | HPA047032 |
| Alternative Catalog Number: | ATA-HPA047032-100,ATA-HPA047032-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CGI-09, GCD10, Gcd10p, MGC5029 |
| tRNA methyltransferase 6 homolog (S. cerevisiae) |
| Anti-TRMT6 |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 51605 |
| UniProt: | Q9UJA5 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KMIVMETCAGLVLGAMMERMGGFGSIIQLYPGGGPVRAATACFGFPKSFLSGLYEFPLNKVDSLLHGTFSAKMLSSEPKDSALVEESNGTLE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TRMT6 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleus. |
|
|
Immunohistochemical staining of human testis shows strong nuclear positivity in cells of seminiferus ducts. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
HPA047032-100ul |
|
|
|
|
|
HPA047032-100ul |
|
|
HPA047032-100ul |
Product Guarantee and Expert Support
