Anti-RPS3A
Catalog Number:
ATA-HPA047100
- Images (6)
| Article Name: | Anti-RPS3A |
| Biozol Catalog Number: | ATA-HPA047100 |
| Supplier Catalog Number: | HPA047100 |
| Alternative Catalog Number: | ATA-HPA047100-100,ATA-HPA047100-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MFTL, S3A |
| ribosomal protein S3A |
| Anti-RPS3A |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 6189 |
| UniProt: | P61247 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QGTKIASDGLKGRVFEVSLADLQNDEVAFRKFKLITEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RPS3A |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line HEK 293 shows localization to cytosol & endoplasmic reticulum. |
|
|
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells. |
|
|
Western blot analysis using Anti-RPS3A antibody HPA047100 (A) shows similar pattern to independent antibody HPA053454 (B). |
|
|
HPA047100-100ul |
|
|
HPA047100-100ul |
|
|
HPA047100-100ul |
Product Guarantee and Expert Support
