Anti-ST13
Catalog Number:
ATA-HPA047114
- Images (6)
| Article Name: | Anti-ST13 |
| Biozol Catalog Number: | ATA-HPA047114 |
| Supplier Catalog Number: | HPA047114 |
| Alternative Catalog Number: | ATA-HPA047114-100,ATA-HPA047114-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FAM10A1, HIP, HSPABP1, P48, SNC6 |
| suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) |
| Anti-ST13 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 6767 |
| UniProt: | P50502 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ST13 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. |
|
|
Immunohistochemical staining of human pancreas shows moderate cytoplasmic and nuclear positivity in islets of Langerhans. |
|
|
Western blot analysis using Anti-ST13 antibody HPA047114 (A) shows similar pattern to independent antibody HPA046412 (B). |
|
|
HPA047114-100ul |
|
|
HPA047114-100ul |
|
|
HPA047114-100ul |
Product Guarantee and Expert Support
