Anti-SKIV2L

Catalog Number: ATA-HPA047122
Article Name: Anti-SKIV2L
Biozol Catalog Number: ATA-HPA047122
Supplier Catalog Number: HPA047122
Alternative Catalog Number: ATA-HPA047122-100,ATA-HPA047122-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: 170A, DDX13, HLP, SKI2W, SKIV2, SKIV2L1
Clonality: Polyclonal
Isotype: IgG
NCBI: 6499
UniProt: Q15477
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TGNSSKTQGELFLLLDSRGAFHTKGYYAAVEAKKERMSKHAQTFGAKQPTHQGGPAQDRGVYLSLLASLRTRAQLPVVV
Target: SKIV2L
Antibody Type: Monoclonal Antibody
HPA047122-100ul