Anti-MRRF
Catalog Number:
ATA-HPA047177
- Images (6)
| Article Name: | Anti-MRRF |
| Biozol Catalog Number: | ATA-HPA047177 |
| Supplier Catalog Number: | HPA047177 |
| Alternative Catalog Number: | ATA-HPA047177-100,ATA-HPA047177-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | RRF |
| mitochondrial ribosome recycling factor |
| Anti-MRRF |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 92399 |
| UniProt: | Q96E11 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ALGLKCFRMVHPTFRNYLAASIRPVSEVTLKTVHERQHGHRQYMAYSAVPVRHFATKKAKAKGKGQSQTRVNINAALVEDIINLEEVNEEMKSV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MRRF |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human parathyroid gland and pancreas tissues using Anti-MRRF antibody. Corresponding MRRF RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human parathyroid gland shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
HPA047177-100ul |
|
|
HPA047177-100ul |
|
|
HPA047177-100ul |
Product Guarantee and Expert Support
