Anti-DKKL1

Catalog Number: ATA-HPA047194
Article Name: Anti-DKKL1
Biozol Catalog Number: ATA-HPA047194
Supplier Catalog Number: HPA047194
Alternative Catalog Number: ATA-HPA047194-100,ATA-HPA047194-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CT34, SGY-1
dickkopf-like 1
Anti-DKKL1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 27120
UniProt: Q9UK85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ADAQESSLGLTGLQSLLQGFSRLFLKGNLLRGIDSLFSAPMDFRGLPGNYHKEENQEHQLGNNTLSSHLQIDKMTDNKTGEVLISENVVASIQPAEGSFEGDLK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: DKKL1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line A549 shows localization to vesicles.
Immunohistochemistry analysis in human testis and prostate tissues using Anti-DKKL1 antibody. Corresponding DKKL1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human prostate shows low expression as expected.
HPA047194-100ul
HPA047194-100ul
HPA047194-100ul