Anti-SYT8

Catalog Number: ATA-HPA047239
Article Name: Anti-SYT8
Biozol Catalog Number: ATA-HPA047239
Supplier Catalog Number: HPA047239
Alternative Catalog Number: ATA-HPA047239-100,ATA-HPA047239-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DKFZp434K0322
Clonality: Polyclonal
Concentration: 0,05
NCBI: 90019
UniProt: Q8NBV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EPYVKVQLMLNQRKWKKRKTATKKGTAAPYFNEAFTFLVPFSQVQNVDLVLAVWDRSLPLRTEPVGKVHLGARASGQPLQHWA
Target: SYT8
HPA047239-100ul