Anti-CPNE1

Catalog Number: ATA-HPA047259
Article Name: Anti-CPNE1
Biozol Catalog Number: ATA-HPA047259
Supplier Catalog Number: HPA047259
Alternative Catalog Number: ATA-HPA047259-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CPN1
copine I
Anti-CPNE1
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 8904
UniProt: Q99829
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KNNLNPTWKRFSVPVQHFCGGNPSTPIQVQCSDYDSDGS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CPNE1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm & nuclear membrane.
Western blot analysis in human cell lines Caco-2 and U2OS using Anti-CPNE1 antibody. Corresponding CPNE1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
HPA047259-100ul
HPA047259-100ul
HPA047259-100ul