Anti-CPNE1
Catalog Number:
ATA-HPA047259
- Images (6)
| Article Name: | Anti-CPNE1 |
| Biozol Catalog Number: | ATA-HPA047259 |
| Supplier Catalog Number: | HPA047259 |
| Alternative Catalog Number: | ATA-HPA047259-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CPN1 |
| copine I |
| Anti-CPNE1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 8904 |
| UniProt: | Q99829 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KNNLNPTWKRFSVPVQHFCGGNPSTPIQVQCSDYDSDGS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CPNE1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm & nuclear membrane. |
|
|
Western blot analysis in human cell lines Caco-2 and U2OS using Anti-CPNE1 antibody. Corresponding CPNE1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1. |
|
|
Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue. |
|
|
HPA047259-100ul |
|
|
HPA047259-100ul |
|
|
HPA047259-100ul |
Product Guarantee and Expert Support
