Anti-PAPOLB

Catalog Number: ATA-HPA047285
Article Name: Anti-PAPOLB
Biozol Catalog Number: ATA-HPA047285
Supplier Catalog Number: HPA047285
Alternative Catalog Number: ATA-HPA047285-100,ATA-HPA047285-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PAPT
Clonality: Polyclonal
Isotype: IgG
NCBI: 56903
UniProt: Q9NRJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SLQQVNTNESSGVALNESIPHAVSQPAISPSPKAMVARVVSSTCLISHPDLQETQQQTYLIL
Target: PAPOLB
Antibody Type: Monoclonal Antibody
HPA047285-100ul