Anti-SNX1
Catalog Number:
ATA-HPA047373
- Images (7)
| Article Name: | Anti-SNX1 |
| Biozol Catalog Number: | ATA-HPA047373 |
| Supplier Catalog Number: | HPA047373 |
| Alternative Catalog Number: | ATA-HPA047373-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HsT17379, MGC8664, SNX1A, Vps5 |
| sorting nexin 1 |
| Anti-SNX1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 6642 |
| UniProt: | Q13596 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GGGGCSASERLPPPFPGLEPESEGAAGGSEPEAGDSDTEGEDIFTGAAVVSKHQSPKITTSLLPI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SNX1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line HeLa shows localization to endosomes & lysosomes. |
|
|
Immunohistochemical staining of human breast shows moderate cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SNX1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
Western blot analysis using Anti-SNX1 antibody HPA047373 (A) shows similar pattern to independent antibody HPA052761 (B). |
|
|
HPA047373-100ul |
|
|
HPA047373-100ul |
|
|
HPA047373-100ul |
Product Guarantee and Expert Support
