Anti-SLC44A3
Catalog Number:
ATA-HPA047433
- Images (8)
| Article Name: | Anti-SLC44A3 |
| Biozol Catalog Number: | ATA-HPA047433 |
| Supplier Catalog Number: | HPA047433 |
| Alternative Catalog Number: | ATA-HPA047433-100,ATA-HPA047433-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CTL3, MGC45474 |
| solute carrier family 44, member 3 |
| Anti-SLC44A3 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 126969 |
| UniProt: | Q8N4M1 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GAAGRLLFGYDSFGNMCGKKNSPVEGAPLSGQDMTLKKHVFFMNSCNLEVKGTQLNRMALCVSNCPEEQLDSLEEVQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLC44A3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human stomach and lymph node tissues using Anti-SLC44A3 antibody. Corresponding SLC44A3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human stomach shows high expression. |
|
|
Immunohistochemical staining of human lymph node shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line RT-4 |
|
|
HPA047433-100ul |
|
|
|
|
|
HPA047433-100ul |
|
|
HPA047433-100ul |
Product Guarantee and Expert Support
