Anti-HSD17B7
Catalog Number:
ATA-HPA047496
- Images (7)
| Article Name: | Anti-HSD17B7 |
| Biozol Catalog Number: | ATA-HPA047496 |
| Supplier Catalog Number: | HPA047496 |
| Alternative Catalog Number: | ATA-HPA047496-100,ATA-HPA047496-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PRAP, SDR37C1 |
| hydroxysteroid (17-beta) dehydrogenase 7 |
| Anti-HSD17B7 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 51478 |
| UniProt: | P56937 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ANAFTLTPYNGTEALVWLFHQKPESLNPLIKYLSATTGFGRNYIMTQKMDLDEDTAEKFYQKLLELEKHIRVTIQKTDNQARLSGSC |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | HSD17B7 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human liver shows moderate positivity in hepatocytes. |
|
|
Immunohistochemical staining of human lung shows moderate cytoplasmic positivity in pneumocytes and macrophages. |
|
|
Immunohistochemical staining of human breast shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows cytoplasmic positivity in myocytes. |
|
|
HPA047496-100ul |
|
|
HPA047496-100ul |
|
|
HPA047496-100ul |
Product Guarantee and Expert Support
