Anti-PLEKHG7

Catalog Number: ATA-HPA047623
Article Name: Anti-PLEKHG7
Biozol Catalog Number: ATA-HPA047623
Supplier Catalog Number: HPA047623
Alternative Catalog Number: ATA-HPA047623-100,ATA-HPA047623-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C12orf74, FLJ46688
Clonality: Polyclonal
Concentration: 0,05
NCBI: 440107
UniProt: Q6ZR37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: IKEGGSCTVLDQPIPLDRLVVKSIEPLHVSVFGLRNAFLIQHENRYRQCIAAFLLQAQTENIKKTWMAQITTAISCFTKSQETKKI
Target: PLEKHG7
HPA047623-100ul