Anti-RABEP2

Catalog Number: ATA-HPA047641
Article Name: Anti-RABEP2
Biozol Catalog Number: ATA-HPA047641
Supplier Catalog Number: HPA047641
Alternative Catalog Number: ATA-HPA047641-100,ATA-HPA047641-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ23282, FRA
rabaptin, RAB GTPase binding effector protein 2
Anti-RABEP2
Clonality: Polyclonal
Concentration: 0.6 mg/ml
Isotype: IgG
NCBI: 79874
UniProt: Q9H5N1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LKAKLLRAEELIQEIQRRPRHAPSLHGSTELLPLSRDPSPPLEPLEELSGDGGPAAEAFAHNCDDSASISSFSLGGGVGSSSSLPQSRQGLSPE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RABEP2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line MCF7 shows localization to cytosol & vesicles.
Immunohistochemical staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
HPA047641-100ul
HPA047641-100ul
HPA047641-100ul