Anti-PRELID3B
Catalog Number:
ATA-HPA047721
- Images (7)
| Article Name: | Anti-PRELID3B |
| Biozol Catalog Number: | ATA-HPA047721 |
| Supplier Catalog Number: | HPA047721 |
| Alternative Catalog Number: | ATA-HPA047721-100,ATA-HPA047721-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C20orf45, dJ543J19.5, SLMO2 |
| PRELI domain containing 3B |
| Anti-PRELID3B |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 51012 |
| UniProt: | Q9Y3B1 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ASTISSNASKGREAMEWVIHKLNAEIEELTASARGTIRTPMAAAAFAEK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PRELID3B |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells and ganglion cells. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line SK-BR-3 |
|
|
|
|
|
HPA047721-100ul |
|
|
HPA047721-100ul |
|
|
HPA047721-100ul |
Product Guarantee and Expert Support
