Anti-B4GALT2

Catalog Number: ATA-HPA047739
Article Name: Anti-B4GALT2
Biozol Catalog Number: ATA-HPA047739
Supplier Catalog Number: HPA047739
Alternative Catalog Number: ATA-HPA047739-100,ATA-HPA047739-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: beta4Gal-T2
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2
Anti-B4GALT2
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 8704
UniProt: O60909
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LPPCPDSPPGLVGRLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREH
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: B4GALT2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human seminal vesicle and pancreas tissues using Anti-B4GALT2 antibody. Corresponding B4GALT2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human seminal vesicle shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
HPA047739-100ul
HPA047739-100ul
HPA047739-100ul