Anti-SMIM4
Catalog Number:
ATA-HPA047771
- Images (6)
| Article Name: | Anti-SMIM4 |
| Biozol Catalog Number: | ATA-HPA047771 |
| Supplier Catalog Number: | HPA047771 |
| Alternative Catalog Number: | ATA-HPA047771-100,ATA-HPA047771-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C3orf78 |
| small integral membrane protein 4 |
| Anti-SMIM4 |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | None |
| UniProt: | Q8WVI0 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | IKVRVGQETFYDVYRRKASERQYQRRLEDE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SMIM4 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm & mitochondria. |
|
|
Immunohistochemical staining of human adrenal gland shows cytoplasmic positivity in glandular cells. |
|
|
|
|
|
HPA047771-100ul |
|
|
HPA047771-100ul |
|
|
HPA047771-100ul |
Product Guarantee and Expert Support
