Anti-RAC1

Catalog Number: ATA-HPA047820
Article Name: Anti-RAC1
Biozol Catalog Number: ATA-HPA047820
Supplier Catalog Number: HPA047820
Alternative Catalog Number: ATA-HPA047820-100,ATA-HPA047820-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: p21-Rac1, Rac-1, TC-25
ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
Anti-RAC1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 5879
UniProt: P63000
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREI
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RAC1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
HPA047820-100ul
HPA047820-100ul
HPA047820-100ul