Anti-NCF1
Catalog Number:
ATA-HPA047836
- Images (6)
| Article Name: | Anti-NCF1 |
| Biozol Catalog Number: | ATA-HPA047836 |
| Supplier Catalog Number: | HPA047836 |
| Alternative Catalog Number: | ATA-HPA047836-100,ATA-HPA047836-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | NCF1A, NOXO2, p47phox, SH3PXD1A |
| neutrophil cytosolic factor 1 |
| Anti-NCF1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 653361 |
| UniProt: | P14598 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | YMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENHQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NCF1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human spleen and cerebral cortex tissues using Anti-NCF1 antibody. Corresponding NCF1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human spleen shows high expression. |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
HPA047836-100ul |
|
|
HPA047836-100ul |
|
|
HPA047836-100ul |
Product Guarantee and Expert Support
