Anti-COLEC12

Catalog Number: ATA-HPA047917
Article Name: Anti-COLEC12
Biozol Catalog Number: ATA-HPA047917
Supplier Catalog Number: HPA047917
Alternative Catalog Number: ATA-HPA047917-100,ATA-HPA047917-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CL-P1, SCARA4, SRCL
collectin sub-family member 12
Anti-COLEC12
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 81035
UniProt: Q5KU26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ITTISQANEQNLKDLQDLHKDAENRTAIKFNQLEERFQLFETDIVNIISNISYTAHHLRTLTSNLNEVRTTCTDTLTKHTDDLTSLNNTLANIRLDSVSLRMQQDLMRSRLDTEVANLSVIMEEMKLVDSKHGQL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: COLEC12
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human placenta and kidney tissues using Anti-COLEC12 antibody. Corresponding COLEC12 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows high expression.
Immunohistochemical staining of human kidney shows low expression as expected.
HPA047917-100ul
HPA047917-100ul
HPA047917-100ul