Anti-MOCOS
Catalog Number:
ATA-HPA047958
| Article Name: |
Anti-MOCOS |
| Biozol Catalog Number: |
ATA-HPA047958 |
| Supplier Catalog Number: |
HPA047958 |
| Alternative Catalog Number: |
ATA-HPA047958-100,ATA-HPA047958-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
ICC, IHC, WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
FLJ20733, HMCS, MOS |
| molybdenum cofactor sulfurase |
| Clonality: |
Polyclonal |
| Concentration: |
0.1 mg/ml |
| Isotype: |
IgG |
| NCBI: |
55034 |
| UniProt: |
Q96EN8 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
NQGLLYDRSWMVVNHNGVCLSQKQEPRLCLIQPFIDLRQRIMVIKAKGMEPIEVPLEENSERTQIRQSRVCADRVSTYDCGEKISSWLSTFFGRPCHLIKQSSNSQRNAKKK |
| Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: |
MOCOS |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
Immunofluorescent staining of human cell line RT4 shows localization to cytosol & mitochondria. |
|
Immunohistochemical staining of human stomach, lower shows strong cytoplasmic positivity in gastric parietal cells. |
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 |
|
HPA047958-100ul |
|
HPA047958-100ul |
|
HPA047958-100ul |