Anti-PLXNB3

Catalog Number: ATA-HPA048046
Article Name: Anti-PLXNB3
Biozol Catalog Number: ATA-HPA048046
Supplier Catalog Number: HPA048046
Alternative Catalog Number: ATA-HPA048046-100,ATA-HPA048046-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PLEXB3, PLEXR, PLXN6
plexin B3
Anti-PLXNB3
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 5365
UniProt: Q9ULL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RLIRVRGTGLDVVQRPLLSVWLEADAEVQASRAQPQDPQPRRSCGAPAADPQACIQLGGGLLQCSTVCSVNSSSLLLCRSPAVPDRAHPQRVFFTLDNVQVDFASAS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PLXNB3
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human cerebral cortex and kidney tissues using Anti-PLXNB3 antibody. Corresponding PLXNB3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human kidney shows low expression as expected.
HPA048046-100ul
HPA048046-100ul
HPA048046-100ul