Anti-CSF3R
Catalog Number:
ATA-HPA048086
- Images (7)
| Article Name: | Anti-CSF3R |
| Biozol Catalog Number: | ATA-HPA048086 |
| Supplier Catalog Number: | HPA048086 |
| Alternative Catalog Number: | ATA-HPA048086-100,ATA-HPA048086-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD114, GCSFR |
| colony stimulating factor 3 receptor (granulocyte) |
| Anti-CSF3R |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 1441 |
| UniProt: | Q99062 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | TPVVFSESRGPALTRLHAMARDPHSLWVGWEPPNPWPQGYVIEWGLGPPSASNSNKTWRMEQNGRATGFLLKENIRPFQLYEIIVTPLYQDTMGPSQHVYAYSQEMAPSHAPELHLKHIGKTWA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CSF3R |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human lymph node shows moderate to strong cytoplasmic positivity in macrophages. |
|
|
Immunohistochemical staining of human stomach shows moderate to strong cytoplasmic positivity in leukocytes. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neuropil. |
|
|
HPA048086-100ul |
|
|
HPA048086-100ul |
|
|
HPA048086-100ul |
Product Guarantee and Expert Support
