Anti-SHOC2

Catalog Number: ATA-HPA048134
Article Name: Anti-SHOC2
Biozol Catalog Number: ATA-HPA048134
Supplier Catalog Number: HPA048134
Alternative Catalog Number: ATA-HPA048134-100,ATA-HPA048134-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0862, SOC-2, SOC2, SUR-8, SUR8
Clonality: Polyclonal
Isotype: IgG
NCBI: 8036
UniProt: Q9UQ13
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LSRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSL
Target: SHOC2
Antibody Type: Monoclonal Antibody
HPA048134-100ul