Anti-VPS39
Catalog Number:
ATA-HPA048192
| Article Name: |
Anti-VPS39 |
| Biozol Catalog Number: |
ATA-HPA048192 |
| Supplier Catalog Number: |
HPA048192 |
| Alternative Catalog Number: |
ATA-HPA048192-100,ATA-HPA048192-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
WB |
| Species Reactivity: |
Human |
| Alternative Names: |
KIAA0770, VAM6 |
| Rabbit Polyclonal VPS39 Antibody against Human VPS39 subunit of HOPS complex. Validated for Western Blot |
| Clonality: |
Polyclonal |
| Concentration: |
0.1 |
| NCBI: |
23339 |
| UniProt: |
Q96JC1 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequence: |
AWCENSICVGFKRDYYLIRVDGKGSIKELFPTGKQLEPLVAPLADGKVAVGQDDLTVVLNEEGICTQKCALNWTDIPVAMEHQPPYIIAVLPRYVEIRTFEPRLLVQSIE |
|
WB Image Caption 1 |