Anti-VPS39, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-VPS39, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA048192
• Supplier Catalog Number: HPA048192
• Alternative Catalog Number: ATA-HPA048192-100,ATA-HPA048192-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Alternative Names: KIAA0770, VAM6

Product Description

Rabbit Polyclonal VPS39 Antibody against Human VPS39 subunit of HOPS complex. Validated for Western Blot

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1
• NCBI: 23339
• UniProt: Q96JC1
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Sequence: AWCENSICVGFKRDYYLIRVDGKGSIKELFPTGKQLEPLVAPLADGKVAVGQDDLTVVLNEEGICTQKCALNWTDIPVAMEHQPPYIIAVLPRYVEIRTFEPRLLVQSIE