Anti-GALNT12

Catalog Number: ATA-HPA048292
Article Name: Anti-GALNT12
Biozol Catalog Number: ATA-HPA048292
Supplier Catalog Number: HPA048292
Alternative Catalog Number: ATA-HPA048292-100,ATA-HPA048292-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GalNAc-T12
polypeptide N-acetylgalactosaminyltransferase 12
Anti-GALNT12
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 79695
UniProt: Q8IXK2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PEGCIAVEAGMDTLIMHLCEETAPENQKFILQEDGSLFHEQSKKCVQAARKESSDSFVPLLRDCTNSDHQK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: GALNT12
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human epididymis and fallopian tube tissues using Anti-GALNT12 antibody. Corresponding GALNT12 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human epididymis shows high expression.
Immunohistochemical staining of human fallopian tube shows low expression as expected.
HPA048292-100ul
HPA048292-100ul
HPA048292-100ul