Anti-ACAD11
Catalog Number:
ATA-HPA048317
- Images (8)
| Article Name: | Anti-ACAD11 |
| Biozol Catalog Number: | ATA-HPA048317 |
| Supplier Catalog Number: | HPA048317 |
| Alternative Catalog Number: | ATA-HPA048317-100,ATA-HPA048317-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ12592 |
| acyl-CoA dehydrogenase family, member 11 |
| Anti-ACAD11 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 84129 |
| UniProt: | Q709F0 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | FSLFYFWPRTVPMINQGSYSENSGIPSMEELISIYCRCRGINSILPNWNFFLALSYFKMAGIAQGVYSRYLLGNNSSEDSFLFANIVQPL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ACAD11 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human kidney and pancreas tissues using HPA048317 antibody. Corresponding ACAD11 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human cerebellum shows moderate granular cytoplasmic positivity in Purkinje cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows moderate granular cytoplasmic positivity in myocytes. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
HPA048317-100ul |
|
|
HPA048317-100ul |
|
|
HPA048317-100ul |
Product Guarantee and Expert Support
