Anti-BSPH1
Catalog Number:
ATA-HPA048335
- Images (6)
| Article Name: | Anti-BSPH1 |
| Biozol Catalog Number: | ATA-HPA048335 |
| Supplier Catalog Number: | HPA048335 |
| Alternative Catalog Number: | ATA-HPA048335-100,ATA-HPA048335-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BSP1, ELSPBP2 |
| binder of sperm protein homolog 1 |
| Anti-BSPH1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 100131137 |
| UniProt: | Q075Z2 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SACIFPVILNELSSTVETITHFPEVTDGECVFPFHYKNGTYYDCIKSKARHKWCSLNKTY |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | BSPH1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human epididymis and endometrium tissues using Anti-BSPH1 antibody. Corresponding BSPH1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human epididymis shows high expression. |
|
|
Immunohistochemical staining of human endometrium shows low expression as expected. |
|
|
HPA048335-100ul |
|
|
HPA048335-100ul |
|
|
HPA048335-100ul |
Product Guarantee and Expert Support
