Anti-SLC26A6
Catalog Number:
ATA-HPA048363
- Images (6)
| Article Name: | Anti-SLC26A6 |
| Biozol Catalog Number: | ATA-HPA048363 |
| Supplier Catalog Number: | HPA048363 |
| Alternative Catalog Number: | ATA-HPA048363-100,ATA-HPA048363-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DKFZp586E1422 |
| solute carrier family 26 (anion exchanger), member 6 |
| Anti-SLC26A6 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 65010 |
| UniProt: | Q9BXS9 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ATVYFANAEFYSDALKQRCGVDVDFLISQKKKLLKKQEQLKLKQLQKEEKLRKQAASPKGASVSINVNTSLEDMRSNNVEDCKMMQVS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLC26A6 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human kidney shows strong cytoplasmic, membranous and nuclear positivity in tubular cells. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and SLC26A6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403342). |
|
|
HPA048363-100ul |
|
|
|
|
|
HPA048363-100ul |
|
|
HPA048363-100ul |
Product Guarantee and Expert Support
