Anti-BPNT1

Catalog Number: ATA-HPA048461
Article Name: Anti-BPNT1
Biozol Catalog Number: ATA-HPA048461
Supplier Catalog Number: HPA048461
Alternative Catalog Number: ATA-HPA048461-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: BPNT1
3(2), 5-bisphosphate nucleotidase 1
Anti-BPNT1
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 10380
UniProt: O95861
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: BPNT1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line HEK 293 shows localization to nuclear speckles.
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in renal tubules.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
HPA048461-100ul
HPA048461-100ul
HPA048461-100ul