Anti-TMEM255A
Catalog Number:
ATA-HPA048470
- Images (6)
| Article Name: | Anti-TMEM255A |
| Biozol Catalog Number: | ATA-HPA048470 |
| Supplier Catalog Number: | HPA048470 |
| Alternative Catalog Number: | ATA-HPA048470-100,ATA-HPA048470-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FAM70A, FLJ20716 |
| transmembrane protein 255A |
| Anti-TMEM255A |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 55026 |
| UniProt: | Q5JRV8 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | FKDMNPTLPALNCSVENTHPTVSYYAHPQVASYNTYYHSPPHLPPYSAYDFQHSGVFPSSPPSGLSDEPQSASPSPSYMWSSSAPPRYSPPY |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TMEM255A |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human stomach, lower shows moderate cytoplasmic and nuclear positivity in glandular cells. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and TMEM255A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413424). |
|
|
HPA048470-100ul |
|
|
|
|
|
HPA048470-100ul |
|
|
HPA048470-100ul |
Product Guarantee and Expert Support
