Anti-CYP17A1
Catalog Number:
ATA-HPA048533
- Images (8)
| Article Name: | Anti-CYP17A1 |
| Biozol Catalog Number: | ATA-HPA048533 |
| Supplier Catalog Number: | HPA048533 |
| Alternative Catalog Number: | ATA-HPA048533-100,ATA-HPA048533-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CPT7, CYP17, P450C17, S17AH |
| cytochrome P450, family 17, subfamily A, polypeptide 1 |
| Anti-CYP17A1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 1586 |
| UniProt: | P05093 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PFLPRHGHMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDIASNNRKGIAFADSGAHWQLHRRLAMATFALFKDGDQKLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CYP17A1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human testis and pancreas tissues using HPA048533 antibody. Corresponding CYP17A1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells. |
|
|
Western blot analysis in human adrenal gland tissue. |
|
|
HPA048533-100ul |
|
|
|
|
|
HPA048533-100ul |
|
|
HPA048533-100ul |
Product Guarantee and Expert Support
