Anti-CFAP73
Catalog Number:
ATA-HPA048539
- Images (8)
| Article Name: | Anti-CFAP73 |
| Biozol Catalog Number: | ATA-HPA048539 |
| Supplier Catalog Number: | HPA048539 |
| Alternative Catalog Number: | ATA-HPA048539-100,ATA-HPA048539-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CCDC42B, MIA2 |
| cilia and flagella associated protein 73 |
| Anti-CFAP73 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 387885 |
| UniProt: | A6NFT4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | FRLALQEKLSTKLPEQAEDHVPPVLRLLEKRQELVDADQALQAQKEVFRTKTAALKQRWEQLEQKERELKGSFI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CFAP73 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
|
Immunofluorescent staining of human cell line REH shows localization to nucleus, nucleoli fibrillar center & vesicles. |
|
|
Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-CFAP73 antibody. Corresponding CFAP73 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human fallopian tube shows high expression. |
|
|
Immunohistochemical staining of human prostate shows low expression as expected. |
|
|
HPA048539-100ul |
|
|
|
|
|
HPA048539-100ul |
|
|
HPA048539-100ul |
Product Guarantee and Expert Support
