Anti-TMEM251
Catalog Number:
ATA-HPA048559
- Images (6)
| Article Name: | Anti-TMEM251 |
| Biozol Catalog Number: | ATA-HPA048559 |
| Supplier Catalog Number: | HPA048559 |
| Alternative Catalog Number: | ATA-HPA048559-100,ATA-HPA048559-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C14orf109, DKFZP564F1123 |
| transmembrane protein 251 |
| Anti-TMEM251 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 26175 |
| UniProt: | Q8N6I4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | TVGYCIIPICLAVICNRHQAFVKASNQISRLQLIDT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TMEM251 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line MCF7 shows localization to the Golgi apparatus & cell junctions. |
|
|
Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in red pulp. |
|
|
HPA048559-100ul |
|
|
|
|
|
HPA048559-100ul |
|
|
HPA048559-100ul |
Product Guarantee and Expert Support
