Anti-GUK1
Catalog Number:
ATA-HPA048587
- Images (6)
| Article Name: | Anti-GUK1 |
| Biozol Catalog Number: | ATA-HPA048587 |
| Supplier Catalog Number: | HPA048587 |
| Alternative Catalog Number: | ATA-HPA048587-100,ATA-HPA048587-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | GUK1 |
| guanylate kinase 1 |
| Anti-GUK1 |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 2987 |
| UniProt: | Q16774 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | GUK1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules. |
|
|
Western blot analysis using Anti-GUK1 antibody HPA048587 (A) shows similar pattern to independent antibody HPA028118 (B). |
|
|
HPA048587-100ul |
|
|
|
|
|
HPA048587-100ul |
|
|
HPA048587-100ul |
Product Guarantee and Expert Support
