Anti-ANKMY1

Catalog Number: ATA-HPA048869
Article Name: Anti-ANKMY1
Biozol Catalog Number: ATA-HPA048869
Supplier Catalog Number: HPA048869
Alternative Catalog Number: ATA-HPA048869-100,ATA-HPA048869-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ20499, ZMYND13
Clonality: Polyclonal
Isotype: IgG
NCBI: 51281
UniProt: Q9P2S6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PFHTLMPAERETFLARKRLLEYMGLQLRQAVFAKESQWDPTWLYLCKRAELIPSHRMKKKGPSLPRGLDVKEQGQIPFFKFCYQCGRSIGVRLLPCPRCYGILTCSKYCKTKAWTEFHKKDCGDLVAIVTQLEQVSRRREE
Target: ANKMY1
Antibody Type: Monoclonal Antibody
HPA048869-100ul