Anti-GAD1

Catalog Number: ATA-HPA048871
Article Name: Anti-GAD1
Biozol Catalog Number: ATA-HPA048871
Supplier Catalog Number: HPA048871
Alternative Catalog Number: ATA-HPA048871-100,ATA-HPA048871-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GAD
Clonality: Polyclonal
Isotype: IgG
NCBI: 2571
UniProt: Q99259
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEKSRLVSAFKER
Target: GAD1
Antibody Type: Monoclonal Antibody
HPA048871-100ul