Anti-ANKFN1

Catalog Number: ATA-HPA048953
Article Name: Anti-ANKFN1
Biozol Catalog Number: ATA-HPA048953
Supplier Catalog Number: HPA048953
Alternative Catalog Number: ATA-HPA048953-100,ATA-HPA048953-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ38335
Clonality: Polyclonal
Isotype: IgG
NCBI: 162282
UniProt: Q8N957
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RKPGKHPHHGGFSRHHRWLRIHSETQSLSLSEGIYTQHLSQACGLAQEPKEAKRAGPALDDPRGLTLAHAASLPEERNSSLQDARPSVRRLYVEPYA
Target: ANKFN1
Antibody Type: Monoclonal Antibody
HPA048953-100ul